SCOP 1.65: Domain d1mfa_2: 1mfa 251H-367H

Lineage for d1mfa_2 (1mfa 251H-367H)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (118 PDB entries)

8. Domain d1mfa_2: 1mfa 251H-367H [19889]
   Other proteins in same PDB: d1mfa_1
   part of Fv SE155-4
   complexed with abe, gal, mma

Details for d1mfa_2

PDB Entry: 1mfa, 1.7 Å

PDB Description: structure of a single-chain fv fragment complexed with a carbohydrate antigen at 1.7 angstroms resolution

SCOP Domain Sequences for d1mfa_2:

Sequence; same for both SEQRES and ATOM records:

>d1mfa_2 b.1.1.1 (251H-367H) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
evqvqqsgtvvarpgasvkmsckasgytftnywmhwikqrpgqglewigaiypgnsatfy
nhkfraktkltavtstttaymelssltsedsavyyctrgghgyygdywgqgasltvs

Timeline for d1mfa_2:

• d1mfa_2 first appeared (with stable ids) in SCOP 1.55
  
• d1mfa_2 appears in SCOP 1.63
  
• d1mfa_2 appears in SCOP 1.67
  
• d1mfa_2 appears in the current release, SCOPe 2.08, called d1mfah1