Lineage for d1mfa_2 (1mfa 251H-367H)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) Superfamily b.1.1: Immunoglobulin [48726] (6 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) 
Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species) 
Species Fab SE155-4 (mouse), lambda L chain [48775] (5 PDB entries) 
Domain d1mfa_2: 1mfa 251H-367H [19889]
Details for d1mfa_2
PDB Entry: 1mfa (more details), 1.7 Å
PDB Description: structure of a single-chain fv fragment complexed with a carbohydrate antigen at 1.7 angstroms resolution
SCOP Domain Sequences for d1mfa_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mfa_2 b.1.1.1 (251H-367H) Immunoglobulin (variable domains of L and H chains) {Fab SE155-4 (mouse), lambda L chain}
evqvqqsgtvvarpgasvkmsckasgytftnywmhwikqrpgqglewigaiypgnsatfy
nhkfraktkltavtstttaymelssltsedsavyyctrgghgyygdywgqgasltvs
SCOP Domain Coordinates for d1mfa_2:
Click to download the PDB-style file with coordinates for d1mfa_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mfa_2:
- d1mfa_2 first appeared (with stable ids) in SCOP 1.55
- d1mfa_2 appears in SCOP 1.57
- d1mfa_2 appears in SCOP 1.61
- d1mfa_2 appears in the current release, SCOPe 2.08, called d1mfah1
View in 3D
