![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein automated matches [190041] (34 species) not a true protein |
![]() | Species Salmonella enterica [TaxId:439842] [189595] (2 PDB entries) |
![]() | Domain d3ak8l_: 3ak8 L: [198885] automated match to d3ak8i_ complexed with mg, so4 |
PDB Entry: 3ak8 (more details), 1.25 Å
SCOPe Domain Sequences for d3ak8l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ak8l_ a.25.1.1 (L:) automated matches {Salmonella enterica [TaxId: 439842]} nllytrndvsesdkkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrta ltdhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryavvandv rkaigeakdedtadiftaasrdldkflwfiesnie
Timeline for d3ak8l_: