Lineage for d1mfa_1 (1mfa 1L-111L)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) 
Species Fab SE155-4 (mouse), lambda L chain [48775] (5 PDB entries) 
Domain d1mfa_1: 1mfa 1L-111L [19888]
Details for d1mfa_1
PDB Entry: 1mfa (more details), 1.7 Å
PDB Description: structure of a single-chain fv fragment complexed with a carbohydrate antigen at 1.7 angstroms resolution
SCOP Domain Sequences for d1mfa_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mfa_1 b.1.1.1 (1L-111L) Immunoglobulin (variable domains of L and H chains) {Fab SE155-4 (mouse), lambda L chain}
qivvtqesalttspgetvtltcrsstgtvtsgnhanwvqekpdhlftgligdtnnrapgv
parfsgsligdkaaltitgaqpedeaiyfcalwsnnhwifgggtkltvlgq
SCOP Domain Coordinates for d1mfa_1:
Click to download the PDB-style file with coordinates for d1mfa_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mfa_1:
- d1mfa_1 appears in SCOP 1.57
- d1mfa_1 appears in the current release, SCOPe 2.08, called d1mfal1
View in 3D
