Lineage for d1mamh1 (1mam H:1-119)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1103461Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1103715Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (46 PDB entries)
    Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4
  8. 1103755Domain d1mamh1: 1mam H:1-119 [19887]
    Other proteins in same PDB: d1mamh2, d1maml1, d1maml2
    part of Fab Yst9.1

Details for d1mamh1

PDB Entry: 1mam (more details), 2.45 Å

PDB Description: crystal structure to 2.45 a resolution of a monoclonal fab specific for the brucella a cell wall polysaccharide antigen
PDB Compounds: (H:) igg2b-kappa yst9.1 fab (heavy chain)

SCOPe Domain Sequences for d1mamh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mamh1 b.1.1.1 (H:1-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evklvesggglvqpggslrlscatsgftftdyymswvrqppgkalewlgfirnkadgytt
eysasvkgrftisrdnsqsilylqmntlraedsatyyctrdpygpaaywgqgtlvtvsa

SCOPe Domain Coordinates for d1mamh1:

Click to download the PDB-style file with coordinates for d1mamh1.
(The format of our PDB-style files is described here.)

Timeline for d1mamh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mamh2