Lineage for d1mamh1 (1mam H:1-119)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52561Species Fab Yst9.1 (mouse), kappa L chain [48774] (1 PDB entry)
  8. 52562Domain d1mamh1: 1mam H:1-119 [19887]
    Other proteins in same PDB: d1mamh2, d1maml2

Details for d1mamh1

PDB Entry: 1mam (more details), 2.45 Å

PDB Description: crystal structure to 2.45 a resolution of a monoclonal fab specific for the brucella a cell wall polysaccharide antigen

SCOP Domain Sequences for d1mamh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mamh1 b.1.1.1 (H:1-119) Immunoglobulin (variable domains of L and H chains) {Fab Yst9.1 (mouse), kappa L chain}
evklvesggglvqpggslrlscatsgftftdyymswvrqppgkalewlgfirnkadgytt
eysasvkgrftisrdnsqsilylqmntlraedsatyyctrdpygpaaywgqgtlvtvsa

SCOP Domain Coordinates for d1mamh1:

Click to download the PDB-style file with coordinates for d1mamh1.
(The format of our PDB-style files is described here.)

Timeline for d1mamh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mamh2