Lineage for d3ag4o2 (3ag4 O:91-227)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771043Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 2771044Protein Cytochrome c oxidase [49544] (4 species)
  7. 2771045Species Cow (Bos taurus) [TaxId:9913] [49545] (50 PDB entries)
  8. 2771069Domain d3ag4o2: 3ag4 O:91-227 [198869]
    Other proteins in same PDB: d3ag4a_, d3ag4b1, d3ag4c_, d3ag4d_, d3ag4e_, d3ag4f_, d3ag4g_, d3ag4h_, d3ag4i_, d3ag4j_, d3ag4k_, d3ag4l_, d3ag4m_, d3ag4n_, d3ag4o1, d3ag4p_, d3ag4q_, d3ag4r_, d3ag4s_, d3ag4t_, d3ag4u_, d3ag4v_, d3ag4w_, d3ag4x_, d3ag4y_, d3ag4z_
    automated match to d1v54b1
    complexed with cdl, chd, cu, cua, cyn, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3ag4o2

PDB Entry: 3ag4 (more details), 2.05 Å

PDB Description: Bovine Heart Cytochrome c Oxidase in the Cyanide Ion-bound Fully Reduced State at 100 K
PDB Compounds: (O:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3ag4o2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ag4o2 b.6.1.2 (O:91-227) Cytochrome c oxidase {Cow (Bos taurus) [TaxId: 9913]}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

SCOPe Domain Coordinates for d3ag4o2:

Click to download the PDB-style file with coordinates for d3ag4o2.
(The format of our PDB-style files is described here.)

Timeline for d3ag4o2: