SCOPe 2.03: Domain d3aeya_: 3aey A:

Lineage for d3aeya_ (3aey A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)

6. Protein Threonine synthase [64172] (4 species)

7. Species Thermus thermophilus [TaxId:274] [102667] (5 PDB entries)

8. Domain d3aeya_: 3aey A: [198853]
   automated match to d1v7ca_
   complexed with so4

Details for d3aeya_

PDB Entry: 3aey, 1.92 Å

PDB Description: Apo form of threonine synthase from Thermus thermophilus HB8

PDB Compounds: (A:) threonine synthase

SCOPe Domain Sequences for d3aeya_:

Sequence; same for both SEQRES and ATOM records:

>d3aeya_ c.79.1.1 (A:) Threonine synthase {Thermus thermophilus [TaxId: 274]}
rpplieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsfk
drgmtlavskaveggaqavacastgntaasaaayaaragilaivvlpagyvalgkvaqsl
vhgarivqvegnfddalrltqklteafpvalvnsvnphrlegqktlafevvdelgdaphy
halpvgnagnitahwmgykayhalgkakrlprmlgfqaagaaplvlgrpverpetlatai
rignpaswqgavrakeesggvieavtdeeilfayrylareegifcepasaaamagvfkll
regrlepestvvltltghglkdpataervaelpppvparleavaaaagll

Timeline for d3aeya_:

• d3aeya_ is new in SCOPe 2.03-stable
  
• d3aeya_ appears in SCOPe 2.04
  
• d3aeya_ appears in the current release, SCOPe 2.08