SCOP 1.55: Domain d1acyh1: 1acy H:1-112

Lineage for d1acyh1 (1acy H:1-112)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab 59.1 (mouse), kappa L chain [48773] (2 PDB entries)

8. Domain d1acyh1: 1acy H:1-112 [19885]
   Other proteins in same PDB: d1acyh2, d1acyl2

Details for d1acyh1

PDB Entry: 1acy, 3 Å

PDB Description: crystal structure of the principal neutralizing site of hiv-1

SCOP Domain Sequences for d1acyh1:

Sequence; same for both SEQRES and ATOM records:

>d1acyh1 b.1.1.1 (H:1-112) Immunoglobulin (variable domains of L and H chains) {Fab 59.1 (mouse), kappa L chain}
qvklqesgpavikpsqslsltcivsgfsitrtnycwhwirqapgkglewmgricyegsiy
yspsiksrstisrdtslnkffiqlisvtnedtamyycsrenhmyetyfdvwgqgttvtvs

Timeline for d1acyh1:

• d1acyh1 appears in SCOP 1.57
  
• d1acyh1 appears in the current release, SCOPe 2.08