Lineage for d3abmb2 (3abm B:91-227)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771043Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 2771044Protein Cytochrome c oxidase [49544] (4 species)
  7. 2771045Species Cow (Bos taurus) [TaxId:9913] [49545] (50 PDB entries)
  8. 2771056Domain d3abmb2: 3abm B:91-227 [198849]
    Other proteins in same PDB: d3abma_, d3abmb1, d3abmc_, d3abmd_, d3abme_, d3abmf_, d3abmg_, d3abmh_, d3abmi_, d3abmj_, d3abmk_, d3abml_, d3abmm_, d3abmn_, d3abmo1, d3abmp_, d3abmq_, d3abmr_, d3abms_, d3abmt_, d3abmu_, d3abmv_, d3abmw_, d3abmx_, d3abmy_, d3abmz_
    automated match to d1v54b1
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d3abmb2

PDB Entry: 3abm (more details), 1.95 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state (200-s X-ray exposure dataset)
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3abmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3abmb2 b.6.1.2 (B:91-227) Cytochrome c oxidase {Cow (Bos taurus) [TaxId: 9913]}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

SCOPe Domain Coordinates for d3abmb2:

Click to download the PDB-style file with coordinates for d3abmb2.
(The format of our PDB-style files is described here.)

Timeline for d3abmb2: