Lineage for d1acyl1 (1acy L:1-108)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2740696Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2741155Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (28 PDB entries)
  8. 2741175Domain d1acyl1: 1acy L:1-108 [19884]
    Other proteins in same PDB: d1acyh1, d1acyh2, d1acyl2
    part of Fab 59.1

Details for d1acyl1

PDB Entry: 1acy (more details), 3 Å

PDB Description: crystal structure of the principal neutralizing site of hiv-1
PDB Compounds: (L:) igg1-kappa 59.1 fab (light chain)

SCOPe Domain Sequences for d1acyl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1acyl1 b.1.1.1 (L:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]}
divmtqspaslvvslgqratiscrasesvdsygksfmhwyqqkpgqppkvliyiasnles
gvparfsgsgsrtdftltidpveaddaatyycqqnnedpptfgagtklemrr

SCOPe Domain Coordinates for d1acyl1:

Click to download the PDB-style file with coordinates for d1acyl1.
(The format of our PDB-style files is described here.)

Timeline for d1acyl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1acyl2