Lineage for d3a5oc1 (3a5o C:6-146)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2492670Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2492671Protein automated matches [226839] (63 species)
    not a true protein
  7. 2493403Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [226006] (4 PDB entries)
  8. 2493404Domain d3a5oc1: 3a5o C:6-146 [198835]
    Other proteins in same PDB: d3a5oc2, d3a5os_
    automated match to d1d4xa1
    complexed with atp, ca

Details for d3a5oc1

PDB Entry: 3a5o (more details), 2.4 Å

PDB Description: Crystal Structure of a Dictyostelium P109I Ca2+-Actin in Complex with Human Gelsolin Segment 1
PDB Compounds: (C:) Major actin

SCOPe Domain Sequences for d3a5oc1:

Sequence, based on SEQRES records: (download)

>d3a5oc1 c.55.1.0 (C:6-146) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
qalvidngsgmckagfagddapravfpsivgrprhtgvmvgmgqkdsyvgdeaqskrgil
tlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteailnpkanrekmtqimfe
tfntpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records): (download)

>d3a5oc1 c.55.1.0 (C:6-146) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
qalvidngsgmckagfagddapravfpsivgrprhtgvmvgkdsyvgdeaqskrgiltlk
ypiehgivtnwddmekiwhhtfynelrvapeehpvllteailnpkanrekmtqimfetfn
tpamyvaiqavlslyasg

SCOPe Domain Coordinates for d3a5oc1:

Click to download the PDB-style file with coordinates for d3a5oc1.
(The format of our PDB-style files is described here.)

Timeline for d3a5oc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3a5oc2
View in 3D
Domains from other chains:
(mouse over for more information)
d3a5os_