SCOPe 2.08: Domain d3a5oc1: 3a5o C:6-146

Lineage for d3a5oc1 (3a5o C:6-146)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (64 species)
   not a true protein

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [226006] (4 PDB entries)

8. Domain d3a5oc1: 3a5o C:6-146 [198835]
   Other proteins in same PDB: d3a5oc2, d3a5os_
   automated match to d1d4xa1
   complexed with atp, ca

Details for d3a5oc1

PDB Entry: 3a5o, 2.4 Å

PDB Description: Crystal Structure of a Dictyostelium P109I Ca2+-Actin in Complex with Human Gelsolin Segment 1

PDB Compounds: (C:) Major actin

SCOPe Domain Sequences for d3a5oc1:

Sequence, based on SEQRES records:

>d3a5oc1 c.55.1.0 (C:6-146) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
qalvidngsgmckagfagddapravfpsivgrprhtgvmvgmgqkdsyvgdeaqskrgil
tlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteailnpkanrekmtqimfe
tfntpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d3a5oc1 c.55.1.0 (C:6-146) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
qalvidngsgmckagfagddapravfpsivgrprhtgvmvgkdsyvgdeaqskrgiltlk
ypiehgivtnwddmekiwhhtfynelrvapeehpvllteailnpkanrekmtqimfetfn
tpamyvaiqavlslyasg

Timeline for d3a5oc1:

• d3a5oc1 first appeared in SCOPe 2.03
  
• d3a5oc1 appears in SCOPe 2.07