Lineage for d3a5mc2 (3a5m C:147-375)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1857402Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1857787Protein automated matches [226905] (12 species)
    not a true protein
  7. 1857907Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [226007] (4 PDB entries)
  8. 1857909Domain d3a5mc2: 3a5m C:147-375 [198832]
    Other proteins in same PDB: d3a5mc1, d3a5ms_
    automated match to d1d4xa2
    complexed with atp, ca, mg

Details for d3a5mc2

PDB Entry: 3a5m (more details), 2.4 Å

PDB Description: Crystal Structure of a Dictyostelium P109I Mg2+-Actin in Complex with Human Gelsolin Segment 1
PDB Compounds: (C:) Major actin

SCOPe Domain Sequences for d3a5mc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a5mc2 c.55.1.1 (C:147-375) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
rttgivmdsgdgvshtvpiyegyalphailrldlagrdltdymmkiltergysftttaaa
aivrdikeklayvaldfeaemqtaasssaleksyelpdgqvitignerfrcpealfqpsf
lgmesagihettynsimkcdvdirkdlygnvvlsggttmfpgiadrmnkeltalapstmk
ikiiapperkysvwiggsilaslstfqqmwiskeeydesgpsivhrkcf

SCOPe Domain Coordinates for d3a5mc2:

Click to download the PDB-style file with coordinates for d3a5mc2.
(The format of our PDB-style files is described here.)

Timeline for d3a5mc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3a5mc1
View in 3D
Domains from other chains:
(mouse over for more information)
d3a5ms_