Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) duplication contains two domains of this fold |
Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
Protein automated matches [226905] (10 species) not a true protein |
Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [226007] (4 PDB entries) |
Domain d3a5mc2: 3a5m C:147-375 [198832] Other proteins in same PDB: d3a5mc1, d3a5ms_ automated match to d1d4xa2 complexed with atp, ca, mg |
PDB Entry: 3a5m (more details), 2.4 Å
SCOPe Domain Sequences for d3a5mc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a5mc2 c.55.1.1 (C:147-375) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]} rttgivmdsgdgvshtvpiyegyalphailrldlagrdltdymmkiltergysftttaaa aivrdikeklayvaldfeaemqtaasssaleksyelpdgqvitignerfrcpealfqpsf lgmesagihettynsimkcdvdirkdlygnvvlsggttmfpgiadrmnkeltalapstmk ikiiapperkysvwiggsilaslstfqqmwiskeeydesgpsivhrkcf
Timeline for d3a5mc2: