SCOPe 2.01: Domain d1ai1h1: 1ai1 H:1-112

Lineage for d1ai1h1 (1ai1 H:1-112)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 7.3 [TaxId:10090] [88559] (2 PDB entries)

8. Domain d1ai1h1: 1ai1 H:1-112 [19883]
   Other proteins in same PDB: d1ai1h2, d1ai1l1, d1ai1l2
   part of Fab 59.1

Details for d1ai1h1

PDB Entry: 1ai1, 2.8 Å

PDB Description: hiv-1 v3 loop mimic

PDB Compounds: (H:) igg1-kappa 59.1 fab (heavy chain)

SCOPe Domain Sequences for d1ai1h1:

Sequence; same for both SEQRES and ATOM records:

>d1ai1h1 b.1.1.1 (H:1-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.3 [TaxId: 10090]}
qvklqesgpavikpsqslsltcivsgfsitrtnycwhwirqapgkglewmgricyegsiy
yspsiksrstisrdtslnkffiqlisvtnedtamyycsrenhmyetyfdvwgqgttvtvs

Timeline for d1ai1h1:

• d1ai1h1 first appeared (with stable ids) in SCOP 1.55
  
• d1ai1h1 appears in SCOP 1.75
  
• d1ai1h1 appears in SCOPe 2.02
  
• d1ai1h1 appears in the current release, SCOPe 2.08