Lineage for d1ai1h1 (1ai1 H:1-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740654Species Mouse (Mus musculus), cluster 7.3 [TaxId:10090] [88559] (2 PDB entries)
  8. 2740655Domain d1ai1h1: 1ai1 H:1-112 [19883]
    Other proteins in same PDB: d1ai1h2, d1ai1l1, d1ai1l2
    part of Fab 59.1

Details for d1ai1h1

PDB Entry: 1ai1 (more details), 2.8 Å

PDB Description: hiv-1 v3 loop mimic
PDB Compounds: (H:) igg1-kappa 59.1 fab (heavy chain)

SCOPe Domain Sequences for d1ai1h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ai1h1 b.1.1.1 (H:1-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.3 [TaxId: 10090]}
qvklqesgpavikpsqslsltcivsgfsitrtnycwhwirqapgkglewmgricyegsiy
yspsiksrstisrdtslnkffiqlisvtnedtamyycsrenhmyetyfdvwgqgttvtvs

SCOPe Domain Coordinates for d1ai1h1:

Click to download the PDB-style file with coordinates for d1ai1h1.
(The format of our PDB-style files is described here.)

Timeline for d1ai1h1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ai1h2