| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Neisseria meningitidis [TaxId:491] [196523] (3 PDB entries) |
| Domain d3a3te1: 3a3t E:24-212 [198828] Other proteins in same PDB: d3a3ta2, d3a3tb2, d3a3tc2, d3a3td2, d3a3te2, d3a3tf2 automated match to d3a3tf_ |
PDB Entry: 3a3t (more details), 2.1 Å
SCOPe Domain Sequences for d3a3te1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a3te1 c.47.1.0 (E:24-212) automated matches {Neisseria meningitidis [TaxId: 491]}
aglvegqnytvlanpipqqqagkvevleffgyfcphcahlepvlskhaksfkddmylrte
hvvwqkemltlarlaaavdmaaadskdvanshifdamvnqkiklqnpevlkkwlgeqtaf
dgkkvlaayespesqaradkmqeltetfqidgtptvivggkykvefadwesgmntidlla
dkvreeqka
Timeline for d3a3te1: