Lineage for d3a3tc_ (3a3t C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1854430Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1854431Protein automated matches [190056] (147 species)
    not a true protein
  7. 1855286Species Neisseria meningitidis [TaxId:491] [196523] (3 PDB entries)
  8. 1855289Domain d3a3tc_: 3a3t C: [198826]
    automated match to d3a3tf_

Details for d3a3tc_

PDB Entry: 3a3t (more details), 2.1 Å

PDB Description: The oxidoreductase NmDsbA1 from N. meningitidis
PDB Compounds: (C:) Thiol:disulfide interchange protein dsbA

SCOPe Domain Sequences for d3a3tc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a3tc_ c.47.1.0 (C:) automated matches {Neisseria meningitidis [TaxId: 491]}
dddkaglvegqnytvlanpipqqqagkvevleffgyfcphcahlepvlskhaksfkddmy
lrtehvvwqkemltlarlaaavdmaaadskdvanshifdamvnqkiklqnpevlkkwlge
qtafdgkkvlaayespesqaradkmqeltetfqidgtptvivggkykvefadwesgmnti
dlladkvreeqka

SCOPe Domain Coordinates for d3a3tc_:

Click to download the PDB-style file with coordinates for d3a3tc_.
(The format of our PDB-style files is described here.)

Timeline for d3a3tc_: