Lineage for d2zxwo2 (2zxw O:91-227)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2043106Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2043107Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2043698Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 2043699Protein Cytochrome c oxidase [49544] (4 species)
  7. 2043700Species Cow (Bos taurus) [TaxId:9913] [49545] (35 PDB entries)
  8. 2043748Domain d2zxwo2: 2zxw O:91-227 [198820]
    Other proteins in same PDB: d2zxwa_, d2zxwb1, d2zxwc_, d2zxwd_, d2zxwe_, d2zxwf_, d2zxwg_, d2zxwh_, d2zxwi_, d2zxwj_, d2zxwk_, d2zxwl_, d2zxwm_, d2zxwn_, d2zxwo1, d2zxwp_, d2zxwq_, d2zxwr_, d2zxws_, d2zxwt_, d2zxwu_, d2zxwv_, d2zxww_, d2zxwx_, d2zxwy_, d2zxwz_
    automated match to d1v54b1
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d2zxwo2

PDB Entry: 2zxw (more details), 2.5 Å

PDB Description: Bovine heart cytochrome c oxidase at the fully oxidized state (1-s X-ray exposure dataset)
PDB Compounds: (O:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d2zxwo2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zxwo2 b.6.1.2 (O:91-227) Cytochrome c oxidase {Cow (Bos taurus) [TaxId: 9913]}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

SCOPe Domain Coordinates for d2zxwo2:

Click to download the PDB-style file with coordinates for d2zxwo2.
(The format of our PDB-style files is described here.)

Timeline for d2zxwo2: