SCOPe 2.06: Domain d2zr1b2: 2zr1 B:141-267

Lineage for d2zr1b2 (2zr1 B:141-267)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.1: Ricin B-like [50371] (11 proteins)

6. Protein Agglutinin-1 chain B [159150] (1 species)

7. Species Abrus precatorius [TaxId:3816] [159151] (2 PDB entries)
   Uniprot Q9M6E9 287-420! Uniprot Q9M6E9 421-547

8. Domain d2zr1b2: 2zr1 B:141-267 [198810]
   Other proteins in same PDB: d2zr1a_, d2zr1c_
   automated match to d2q3nb1
   complexed with nag, ndg

Details for d2zr1b2

PDB Entry: 2zr1, 2.6 Å

PDB Description: agglutinin from abrus precatorius

PDB Compounds: (B:) Agglutinin-1 chain B

SCOPe Domain Sequences for d2zr1b2:

Sequence; same for both SEQRES and ATOM records:

>d2zr1b2 b.42.2.1 (B:141-267) Agglutinin-1 chain B {Abrus precatorius [TaxId: 3816]}
dtspfvtsiagffklcmeahgnsmwldvcditkeeqqwavypdgsirpvqntnncltcee
hkqgativmmgcsnawasqrwvfksdgtiynlyddmvmdvkssdpslkqiilwpytgnan
qmwatlf

Timeline for d2zr1b2:

• d2zr1b2 first appeared in SCOPe 2.03
  
• d2zr1b2 appears in SCOPe 2.05
  
• d2zr1b2 appears in SCOPe 2.07
  
• d2zr1b2 appears in the current release, SCOPe 2.08