Lineage for d2zr1b1 (2zr1 B:5-140)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1316302Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1316646Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 1316647Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 1316661Protein Agglutinin-1 chain B [159150] (1 species)
  7. 1316662Species Abrus precatorius [TaxId:3816] [159151] (2 PDB entries)
    Uniprot Q9M6E9 287-420! Uniprot Q9M6E9 421-547
  8. 1316663Domain d2zr1b1: 2zr1 B:5-140 [198809]
    Other proteins in same PDB: d2zr1a_, d2zr1c_
    automated match to d2q3nb2
    complexed with nag, ndg

Details for d2zr1b1

PDB Entry: 2zr1 (more details), 2.6 Å

PDB Description: agglutinin from abrus precatorius
PDB Compounds: (B:) Agglutinin-1 chain B

SCOPe Domain Sequences for d2zr1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zr1b1 b.42.2.1 (B:5-140) Agglutinin-1 chain B {Abrus precatorius [TaxId: 3816]}
skicsshyeptvriggrdglcvdvsdnaynngnpiilwkckdqlevnqlwtlksdktirs
kgkclttygyapgnyvmiydcssavaeatywdiwdngtiinpksglvlsaesssmggtlt
vqkndyrmrqgwrtgn

SCOPe Domain Coordinates for d2zr1b1:

Click to download the PDB-style file with coordinates for d2zr1b1.
(The format of our PDB-style files is described here.)

Timeline for d2zr1b1: