Lineage for d2zkic_ (2zki C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2464623Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2465166Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2465167Protein automated matches [190158] (30 species)
    not a true protein
  7. 2465364Species Sulfolobus tokodaii [TaxId:111955] [188428] (1 PDB entry)
  8. 2465367Domain d2zkic_: 2zki C: [198804]
    automated match to d2zkid_
    complexed with so4

Details for d2zkic_

PDB Entry: 2zki (more details), 2.9 Å

PDB Description: Crystal structure of hypothetical Trp repressor binding protein from Sul folobus tokodaii (ST0872)
PDB Compounds: (C:) 199aa long hypothetical Trp repressor binding protein

SCOPe Domain Sequences for d2zkic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zkic_ c.23.5.0 (C:) automated matches {Sulfolobus tokodaii [TaxId: 111955]}
ckpnilvlfygygsivelakeigkgaeeagaevkirrvretlppefqsripfdkvkdipe
vtlddmrwadgfaigsptrygnmagglktfldttailwkdnvlygkpvtffteastvhgg
hettiltmstyayhfgmiivpigygipelfqtttgggpygathlgskeeldemerkiarf
qgkritevakaikcc

SCOPe Domain Coordinates for d2zkic_:

Click to download the PDB-style file with coordinates for d2zkic_.
(The format of our PDB-style files is described here.)

Timeline for d2zkic_: