Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) |
Family c.23.5.0: automated matches [191330] (1 protein) not a true family |
Protein automated matches [190158] (30 species) not a true protein |
Species Sulfolobus tokodaii [TaxId:111955] [188428] (1 PDB entry) |
Domain d2zkib_: 2zki B: [198803] automated match to d2zkid_ complexed with so4 |
PDB Entry: 2zki (more details), 2.9 Å
SCOPe Domain Sequences for d2zkib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zkib_ c.23.5.0 (B:) automated matches {Sulfolobus tokodaii [TaxId: 111955]} ckpnilvlfygygsivelakeigkgaeeagaevkirrvretlppefqsripfdkvkdipe vtlddmrwadgfaigsptrygnmagglktfldttailwkdnvlygkpvtffteastvhgg hettiltmstyayhfgmiivpigygipelfqtttgggpygathlgskeeldemerkiarf qgkritevakaikcc
Timeline for d2zkib_: