![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
![]() | Protein automated matches [190396] (40 species) not a true protein |
![]() | Species Human immunodeficiency virus 1 [TaxId:11676] [225129] (16 PDB entries) |
![]() | Domain d2ze2a2: 2ze2 A:430-552 [198801] Other proteins in same PDB: d2ze2a1, d2ze2b_ automated match to d1bqna1 protein/DNA complex; protein/RNA complex; complexed with t27; mutant |
PDB Entry: 2ze2 (more details), 2.9 Å
SCOPe Domain Sequences for d2ze2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ze2a2 c.55.3.0 (A:430-552) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]} ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd klv
Timeline for d2ze2a2: