SCOPe 2.02: Domain d1ggcl1: 1ggc L:1-107

Lineage for d1ggcl1 (1ggc L:1-107)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (15 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (30 PDB entries)

8. Domain d1ggcl1: 1ggc L:1-107 [19880]
   Other proteins in same PDB: d1ggch1, d1ggch2, d1ggcl2
   part of Fab 50.1

Details for d1ggcl1

PDB Entry: 1ggc, 2.8 Å

PDB Description: major antigen-induced domain rearrangements in an antibody

PDB Compounds: (L:) igg2a-kappa 50.1 fab (light chain)

SCOPe Domain Sequences for d1ggcl1:

Sequence; same for both SEQRES and ATOM records:

>d1ggcl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]}
divltqspgslavslgqratiscrasesvdddgnsflhwyqqkpgqppklliyrssnlis
gipdrfsgsgsrtdftltinpveaddvatyycqqsnedpltfgagtkleik

Timeline for d1ggcl1:

• d1ggcl1 first appeared (with stable ids) in SCOP 1.55
  
• d1ggcl1 appears in SCOPe 2.01
  
• d1ggcl1 appears in SCOPe 2.03
  
• d1ggcl1 appears in the current release, SCOPe 2.08