Lineage for d1ggcl1 (1ggc L:1-107)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 363425Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 363752Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (24 PDB entries)
  8. 363771Domain d1ggcl1: 1ggc L:1-107 [19880]
    Other proteins in same PDB: d1ggch1, d1ggch2, d1ggcl2
    part of Fab 50.1

Details for d1ggcl1

PDB Entry: 1ggc (more details), 2.8 Å

PDB Description: major antigen-induced domain rearrangements in an antibody

SCOP Domain Sequences for d1ggcl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggcl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2}
divltqspgslavslgqratiscrasesvdddgnsflhwyqqkpgqppklliyrssnlis
gipdrfsgsgsrtdftltinpveaddvatyycqqsnedpltfgagtkleik

SCOP Domain Coordinates for d1ggcl1:

Click to download the PDB-style file with coordinates for d1ggcl1.
(The format of our PDB-style files is described here.)

Timeline for d1ggcl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ggcl2