SCOP 1.55: Domain d1ggcl1: 1ggc L:1-107

Lineage for d1ggcl1 (1ggc L:1-107)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab 50.1 (mouse), kappa L chain [48772] (3 PDB entries)

8. Domain d1ggcl1: 1ggc L:1-107 [19880]
   Other proteins in same PDB: d1ggch2, d1ggcl2

Details for d1ggcl1

PDB Entry: 1ggc, 2.8 Å

PDB Description: major antigen-induced domain rearrangements in an antibody

SCOP Domain Sequences for d1ggcl1:

Sequence; same for both SEQRES and ATOM records:

>d1ggcl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Fab 50.1 (mouse), kappa L chain}
divltqspgslavslgqratiscrasesvdddgnsflhwyqqkpgqppklliyrssnlis
gipdrfsgsgsrtdftltinpveaddvatyycqqsnedpltfgagtkleik

Timeline for d1ggcl1:

• d1ggcl1 appears in SCOP 1.57
  
• d1ggcl1 appears in the current release, SCOPe 2.08