SCOPe 2.05: Domain d2zchl2: 2zch L:108-211

Lineage for d2zchl2 (2zch L:108-211)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)

8. Domain d2zchl2: 2zch L:108-211 [198797]
   Other proteins in same PDB: d2zchl1, d2zchp_
   automated match to d1c12a2
   complexed with cl, ndg, po4

Details for d2zchl2

PDB Entry: 2zch, 2.83 Å

PDB Description: crystal structure of human prostate specific antigen complexed with an activating antibody

PDB Compounds: (L:) monoclonal antibody 8G8F5 Fab

SCOPe Domain Sequences for d2zchl2:

Sequence; same for both SEQRES and ATOM records:

>d2zchl2 b.1.1.2 (L:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d2zchl2:

• d2zchl2 first appeared in SCOPe 2.03
  
• d2zchl2 appears in SCOPe 2.04
  
• d2zchl2 appears in SCOPe 2.06
  
• d2zchl2 appears in the current release, SCOPe 2.08