Lineage for d2zchl1 (2zch L:1-107)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1766572Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)
  8. 1767042Domain d2zchl1: 2zch L:1-107 [198796]
    Other proteins in same PDB: d2zchl2, d2zchp_
    automated match to d1c12a1
    complexed with cl, ndg, po4

Details for d2zchl1

PDB Entry: 2zch (more details), 2.83 Å

PDB Description: crystal structure of human prostate specific antigen complexed with an activating antibody
PDB Compounds: (L:) monoclonal antibody 8G8F5 Fab

SCOPe Domain Sequences for d2zchl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zchl1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspaslavslgqratisckasqsvdfdgdsymnwyqqkpgqppkllifaasnlas
giparlsgsgsgtdftlniqpveeedaatyycqqsnedpytfgggtkleik

SCOPe Domain Coordinates for d2zchl1:

Click to download the PDB-style file with coordinates for d2zchl1.
(The format of our PDB-style files is described here.)

Timeline for d2zchl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zchl2
View in 3D
Domains from other chains:
(mouse over for more information)
d2zchp_