SCOPe 2.03: Domain d2zchl1: 2zch L:1-107

Lineage for d2zchl1 (2zch L:1-107)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries)

8. Domain d2zchl1: 2zch L:1-107 [198796]
   Other proteins in same PDB: d2zchl2, d2zchp_
   automated match to d1c12a1
   complexed with cl, ndg, po4

Details for d2zchl1

PDB Entry: 2zch, 2.83 Å

PDB Description: crystal structure of human prostate specific antigen complexed with an activating antibody

PDB Compounds: (L:) monoclonal antibody 8G8F5 Fab

SCOPe Domain Sequences for d2zchl1:

Sequence; same for both SEQRES and ATOM records:

>d2zchl1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspaslavslgqratisckasqsvdfdgdsymnwyqqkpgqppkllifaasnlas
giparlsgsgsgtdftlniqpveeedaatyycqqsnedpytfgggtkleik

Timeline for d2zchl1:

• d2zchl1 is new in SCOPe 2.03-stable
  
• d2zchl1 appears in SCOPe 2.04
  
• d2zchl1 appears in the current release, SCOPe 2.08