Lineage for d2z7fi_ (2z7f I:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2636719Superfamily g.3.14: Elafin-like [57256] (2 families) (S)
    automatically mapped to Pfam PF00095
  5. 2636748Family g.3.14.0: automated matches [227231] (1 protein)
    not a true family
  6. 2636749Protein automated matches [226980] (1 species)
    not a true protein
  7. 2636750Species Human (Homo sapiens) [TaxId:9606] [225518] (1 PDB entry)
  8. 2636751Domain d2z7fi_: 2z7f I: [198794]
    Other proteins in same PDB: d2z7fe_
    automated match to d1flei_

Details for d2z7fi_

PDB Entry: 2z7f (more details), 1.7 Å

PDB Description: crystal structure of the complex of human neutrophil elastase with 1/2slpi
PDB Compounds: (I:) Antileukoproteinase

SCOPe Domain Sequences for d2z7fi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z7fi_ g.3.14.0 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrkpgkcpvtygqclmlnppnfcemdgqckrdlkccmgmcgkscvspvka

SCOPe Domain Coordinates for d2z7fi_:

Click to download the PDB-style file with coordinates for d2z7fi_.
(The format of our PDB-style files is described here.)

Timeline for d2z7fi_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2z7fe_