SCOPe 2.03: Domain d2z7fi_: 2z7f I:

Lineage for d2z7fi_ (2z7f I:)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.14: Elafin-like [57256] (2 families)
   automatically mapped to Pfam PF00095

5. Family g.3.14.0: automated matches [227231] (1 protein)
   not a true family

6. Protein automated matches [226980] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225518] (1 PDB entry)

8. Domain d2z7fi_: 2z7f I: [198794]
   Other proteins in same PDB: d2z7fe_
   automated match to d1flei_

Details for d2z7fi_

PDB Entry: 2z7f, 1.7 Å

PDB Description: crystal structure of the complex of human neutrophil elastase with 1/2slpi

PDB Compounds: (I:) Antileukoproteinase

SCOPe Domain Sequences for d2z7fi_:

Sequence; same for both SEQRES and ATOM records:

>d2z7fi_ g.3.14.0 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrkpgkcpvtygqclmlnppnfcemdgqckrdlkccmgmcgkscvspvka

Timeline for d2z7fi_:

• d2z7fi_ is new in SCOPe 2.03-stable
  
• d2z7fi_ appears in SCOPe 2.04
  
• d2z7fi_ appears in the current release, SCOPe 2.08