SCOPe 2.08: Domain d2z4qa2: 2z4q A:113-219

Lineage for d2z4qa2 (2z4q A:113-219)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d2z4qa2: 2z4q A:113-219 [198793]
   Other proteins in same PDB: d2z4qa1, d2z4qb1, d2z4qb2
   automated match to d1blna2
   complexed with cd, cl

Details for d2z4qa2

PDB Entry: 2z4q, 2.3 Å

PDB Description: Crystal structure of a murine antibody FAB 528

PDB Compounds: (A:) anti egfr antibody fab, light chain

SCOPe Domain Sequences for d2z4qa2:

Sequence; same for both SEQRES and ATOM records:

>d2z4qa2 b.1.1.2 (A:113-219) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfyprdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d2z4qa2:

• d2z4qa2 first appeared in SCOPe 2.03
  
• d2z4qa2 appears in SCOPe 2.07