Lineage for d2z0yb1 (2z0y B:67-228)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921212Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 2921213Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 2921365Family c.116.1.5: YggJ C-terminal domain-like [89632] (4 proteins)
    contains extra strand (3) in the parallel beta-sheet, order 321546; similar dimerisation to the MTH1 domain
  6. 2921372Protein Hypothetical protein TTHA0657 (TT1575) [117494] (1 species)
  7. 2921373Species Thermus thermophilus [TaxId:274] [117495] (3 PDB entries)
    Uniprot Q5SKI6
  8. 2921379Domain d2z0yb1: 2z0y B:67-228 [198791]
    Other proteins in same PDB: d2z0ya1
    automated match to d1v6za2
    complexed with sam

Details for d2z0yb1

PDB Entry: 2z0y (more details), 2.8 Å

PDB Description: Crystal structure of TTHA0657-SAM complex
PDB Compounds: (B:) Putative uncharacterized protein TTHA0657

SCOPe Domain Sequences for d2z0yb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z0yb1 c.116.1.5 (B:67-228) Hypothetical protein TTHA0657 (TT1575) {Thermus thermophilus [TaxId: 274]}
revgvevvlyvallkgdklaevvraatelgatriqplvtrhsvpkemgegklrrlraval
eaakqsgrvvvpevlppiplkavpqvaqglvahvgatarvrevldpekplalavgpeggf
aeeevalleargftpvslgrrilraetaalallalctagegr

SCOPe Domain Coordinates for d2z0yb1:

Click to download the PDB-style file with coordinates for d2z0yb1.
(The format of our PDB-style files is described here.)

Timeline for d2z0yb1: