Lineage for d2yvjp3 (2yvj P:309-400)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182994Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2182995Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 2182996Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 protein domains)
  6. 2183109Protein NADH-dependent ferredoxin reductase, BphA4 [55434] (1 species)
  7. 2183110Species Pseudomonas sp., KKS102 [TaxId:306] [55435] (9 PDB entries)
  8. 2183119Domain d2yvjp3: 2yvj P:309-400 [198784]
    Other proteins in same PDB: d2yvja1, d2yvja2, d2yvja4, d2yvjb_, d2yvjp1, d2yvjp2, d2yvjp4
    automated match to d1d7ya3
    complexed with fad, fes, nai

Details for d2yvjp3

PDB Entry: 2yvj (more details), 1.9 Å

PDB Description: Crystal structure of the ferredoxin-ferredoxin reductase (BPHA3-BPHA4)complex
PDB Compounds: (P:) Ferredoxin reductase

SCOPe Domain Sequences for d2yvjp3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yvjp3 d.87.1.1 (P:309-400) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]}
tapgyaelpwywsdqgalriqvaglasgdeeivrgevsldapkftlielqkgrivgatcv
nnardfaplrrllavgakpdraaladpatdlr

SCOPe Domain Coordinates for d2yvjp3:

Click to download the PDB-style file with coordinates for d2yvjp3.
(The format of our PDB-style files is described here.)

Timeline for d2yvjp3: