SCOPe 2.06: Domain d2yvja3: 2yvj A:309-400

Lineage for d2yvja3 (2yvj A:309-400)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
   core: beta(3,4)-alpha(3); alpha+beta sandwich

4. Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family)
   both first two domains are of same beta/beta/alpha fold

5. Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)

6. Protein NADH-dependent ferredoxin reductase, BphA4 [55434] (1 species)

7. Species Pseudomonas sp., KKS102 [TaxId:306] [55435] (9 PDB entries)

8. Domain d2yvja3: 2yvj A:309-400 [198781]
   Other proteins in same PDB: d2yvja1, d2yvja2, d2yvja4, d2yvjb_, d2yvjp1, d2yvjp2, d2yvjp4
   automated match to d1d7ya3
   complexed with fad, fes, nai

Details for d2yvja3

PDB Entry: 2yvj, 1.9 Å

PDB Description: Crystal structure of the ferredoxin-ferredoxin reductase (BPHA3-BPHA4)complex

PDB Compounds: (A:) Ferredoxin reductase

SCOPe Domain Sequences for d2yvja3:

Sequence; same for both SEQRES and ATOM records:

>d2yvja3 d.87.1.1 (A:309-400) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]}
tapgyaelpwywsdqgalriqvaglasgdeeivrgevsldapkftlielqkgrivgatcv
nnardfaplrrllavgakpdraaladpatdlr

Timeline for d2yvja3:

• d2yvja3 first appeared in SCOPe 2.03
  
• d2yvja3 appears in SCOPe 2.05
  
• d2yvja3 appears in SCOPe 2.07
  
• d2yvja3 appears in the current release, SCOPe 2.08