Lineage for d2yvja2 (2yvj A:116-236)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1351449Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1351450Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) (S)
  5. 1351953Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 1352169Protein NADH-dependent ferredoxin reductase, BphA4 [51957] (1 species)
  7. 1352170Species Pseudomonas sp., KKS102 [TaxId:306] [51958] (9 PDB entries)
  8. 1352186Domain d2yvja2: 2yvj A:116-236 [198780]
    Other proteins in same PDB: d2yvja3, d2yvjb_, d2yvjp3
    automated match to d1d7ya2
    complexed with fad, fes, nai

Details for d2yvja2

PDB Entry: 2yvj (more details), 1.9 Å

PDB Description: Crystal structure of the ferredoxin-ferredoxin reductase (BPHA3-BPHA4)complex
PDB Compounds: (A:) Ferredoxin reductase

SCOPe Domain Sequences for d2yvja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yvja2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]}
lptlqgatmpvhtlrtledarriqaglrpqsrllivgggviglelaatartagvhvslve
tqprlmsraapatladfvaryhaaqgvdlrfersvtgsvdgvvllddgtriaadmvvvgi
g

SCOPe Domain Coordinates for d2yvja2:

Click to download the PDB-style file with coordinates for d2yvja2.
(The format of our PDB-style files is described here.)

Timeline for d2yvja2: