Lineage for d1ggim1 (1ggi M:1-107)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287738Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287999Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (23 PDB entries)
  8. 288016Domain d1ggim1: 1ggi M:1-107 [19878]
    Other proteins in same PDB: d1ggih1, d1ggih2, d1ggij1, d1ggij2, d1ggil2, d1ggim2
    part of Fab 50.1

Details for d1ggim1

PDB Entry: 1ggi (more details), 2.8 Å

PDB Description: crystal structure of an hiv-1 neutralizing antibody 50.1 in complex with its v3 loop peptide antigen

SCOP Domain Sequences for d1ggim1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggim1 b.1.1.1 (M:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2}
divltqspgslavslgqratiscrasesvdddgnsflhwyqqkpgqppklliyrssnlis
gipdrfsgsgsrtdftltinpveaddvatyycqqsnedpltfgagtkleik

SCOP Domain Coordinates for d1ggim1:

Click to download the PDB-style file with coordinates for d1ggim1.
(The format of our PDB-style files is described here.)

Timeline for d1ggim1: