Lineage for d2ypra_ (2ypr A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1258750Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1259172Family a.4.5.21: ets domain [46859] (9 proteins)
  6. 1259217Protein automated matches [191121] (2 species)
    not a true protein
  7. 1259218Species Human (Homo sapiens) [TaxId:9606] [193283] (2 PDB entries)
  8. 1259219Domain d2ypra_: 2ypr A: [198774]
    automated match to d2yprb_
    complexed with gol

Details for d2ypra_

PDB Entry: 2ypr (more details), 2.64 Å

PDB Description: crystal structure of the dna binding ets domain of human protein fev
PDB Compounds: (A:) protein fev

SCOPe Domain Sequences for d2ypra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ypra_ a.4.5.21 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgsgqiqlwqfllelladranagciawegghgefkltdpdevarrwgerkskpnmnydkl
sralryyydknimskvhgkryayrfdfqglaqacqp

SCOPe Domain Coordinates for d2ypra_:

Click to download the PDB-style file with coordinates for d2ypra_.
(The format of our PDB-style files is described here.)

Timeline for d2ypra_: