SCOPe 2.03: Domain d2ypra_: 2ypr A:

Lineage for d2ypra_ (2ypr A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.21: ets domain [46859] (9 proteins)

6. Protein automated matches [191121] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193283] (2 PDB entries)

8. Domain d2ypra_: 2ypr A: [198774]
   automated match to d2yprb_
   complexed with gol

Details for d2ypra_

PDB Entry: 2ypr, 2.64 Å

PDB Description: crystal structure of the dna binding ets domain of human protein fev

PDB Compounds: (A:) protein fev

SCOPe Domain Sequences for d2ypra_:

Sequence; same for both SEQRES and ATOM records:

>d2ypra_ a.4.5.21 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgsgqiqlwqfllelladranagciawegghgefkltdpdevarrwgerkskpnmnydkl
sralryyydknimskvhgkryayrfdfqglaqacqp

Timeline for d2ypra_:

• d2ypra_ is new in SCOPe 2.03-stable
  
• d2ypra_ appears in SCOPe 2.04
  
• d2ypra_ appears in the current release, SCOPe 2.08