Lineage for d2yppb_ (2ypp B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086424Family c.1.10.8: Class-II DAHP synthetase [141840] (2 protein domains)
    Pfam PF01474
  6. 2086439Protein automated matches [191084] (3 species)
    not a true protein
  7. 2086444Species Mycobacterium tuberculosis [TaxId:83332] [189029] (7 PDB entries)
  8. 2086449Domain d2yppb_: 2ypp B: [198773]
    automated match to d3rzib_
    complexed with cl, gol, mn, so4, tyr

Details for d2yppb_

PDB Entry: 2ypp (more details), 2.3 Å

PDB Description: 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase in complex with 3 tyrosine molecules
PDB Compounds: (B:) phospho-2-dehydro-3-deoxyheptonate aldolase arog

SCOPe Domain Sequences for d2yppb_:

Sequence, based on SEQRES records: (download)

>d2yppb_ c.1.10.8 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mnwtvdipidqlpslpplptdlrtrldaalakpaaqqptwpadqalamrtvlesvppvtv
pseivrlqeqlaqvakgeafllqggdcaetfmdntephirgnvrallqmavvltygasmp
vvkvariagqyakprsadidalglrsyrgdmingfapdaaarehdpsrlvrayanasaam
nlvraltssglaslhlvhdwnrefvrtspagaryealateidrglrfmsacgvadrnlqt
aeiyashealvldyeramlrlsdgddgepqlfdlsahtvwigertrqidgahiafaqvia
npvgvklgpnmtpelaveyverldphnkpgrltlvsrmgnhkvrdllppivekvqatghq
viwqcdpmhgnthesstgfktrhfdrivdevqgffevhralgthpggihveitgenvtec
lggaqdisetdlagryetacdprlntqqslelaflvaemlrd

Sequence, based on observed residues (ATOM records): (download)

>d2yppb_ c.1.10.8 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mnwtvdipipslpplptdlrtrldaalakpaaqqptwpadqalamrtvlesvppvtvpse
ivrlqeqlaqvakgeafllqggdcaetfmdntephirgnvrallqmavvltygasmpvvk
variagqyakprsadidalglrsyrgdmingfapdaaarehdpsrlvrayanasaamnlv
raltssglaslhlvhdwnrefvrtspagaryealateidrglrfmsacgvadrnlqtaei
yashealvldyeramlrlsdgddgepqlfdlsahtvwigertrqidgahiafaqvianpv
gvklgpnmtpelaveyverldphnkpgrltlvsrmgnhkvrdllppivekvqatghqviw
qcdpmhgnthesstgfktrhfdrivdevqgffevhralgthpggihveitgenvteclgg
aqdisetdlagryetacdprlntqqslelaflvaemlrd

SCOPe Domain Coordinates for d2yppb_:

Click to download the PDB-style file with coordinates for d2yppb_.
(The format of our PDB-style files is described here.)

Timeline for d2yppb_: