Lineage for d2ypgd_ (2ypg D:)

  1. Root: SCOPe 2.03
  2. 1466120Class h: Coiled coil proteins [57942] (7 folds)
  3. 1467291Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1467292Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. 1467293Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. 1467294Protein Influenza hemagglutinin (stalk) [58066] (2 species)
    trimer
  7. 1467295Species Influenza A virus, different strains [TaxId:11320] [58067] (45 PDB entries)
  8. 1467327Domain d2ypgd_: 2ypg D: [198771]
    Other proteins in same PDB: d2ypga_, d2ypgc_, d2ypge_
    automated match to d2viub_
    complexed with flc, nag

Details for d2ypgd_

PDB Entry: 2ypg (more details), 2.85 Å

PDB Description: Haemagglutinin of 1968 Human H3N2 Virus in Complex with Human Receptor Analogue LSTc
PDB Compounds: (D:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d2ypgd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ypgd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfq

SCOPe Domain Coordinates for d2ypgd_:

Click to download the PDB-style file with coordinates for d2ypgd_.
(The format of our PDB-style files is described here.)

Timeline for d2ypgd_: