Lineage for d1ggih1 (1ggi H:1-112)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52115Species Fab 50.1 (mouse), kappa L chain [48772] (3 PDB entries)
  8. 52120Domain d1ggih1: 1ggi H:1-112 [19877]
    Other proteins in same PDB: d1ggih2, d1ggij2, d1ggil2, d1ggim2

Details for d1ggih1

PDB Entry: 1ggi (more details), 2.8 Å

PDB Description: crystal structure of an hiv-1 neutralizing antibody 50.1 in complex with its v3 loop peptide antigen

SCOP Domain Sequences for d1ggih1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggih1 b.1.1.1 (H:1-112) Immunoglobulin (variable domains of L and H chains) {Fab 50.1 (mouse), kappa L chain}
qvqlkesgpgilqpsqtlsltcsfsgfslstygmgvswirqpsgkglewlahifwdgdkr
ynpslksrlkiskdtsnnqvflkitsvdtadtatyycvqegyiywgqgtsvtvs

SCOP Domain Coordinates for d1ggih1:

Click to download the PDB-style file with coordinates for d1ggih1.
(The format of our PDB-style files is described here.)

Timeline for d1ggih1: