Lineage for d2yoyb_ (2yoy B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766145Species Bacillus amyloliquefaciens [TaxId:1390] [197052] (4 PDB entries)
  8. 2766147Domain d2yoyb_: 2yoy B: [198769]
    automated match to d2yoya_
    complexed with cu1, edo

Details for d2yoyb_

PDB Entry: 2yoy (more details), 1.7 Å

PDB Description: Bacillus amyloliquefaciens CBM33 in complex with Cu(I) reduced using ascorbate
PDB Compounds: (B:) rbam17540

SCOPe Domain Sequences for d2yoyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yoyb_ b.1.18.0 (B:) automated matches {Bacillus amyloliquefaciens [TaxId: 1390]}
hgyikepvsraymgalekqtmgwtaaaqkygsvidnpqsvegpkgfpaagppdgriasan
ggsgqidfgldkqtadhwvkqnirggfntftwhytaphatskwhyyitkknwnpnkplsr
defeligtvnhdgskadtnlthkifvptdrsgyhiilgvwdvadtsnafynvidvnlt

SCOPe Domain Coordinates for d2yoyb_:

Click to download the PDB-style file with coordinates for d2yoyb_.
(The format of our PDB-style files is described here.)

Timeline for d2yoyb_: