Class b: All beta proteins [48724] (174 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) |
Family b.2.2.0: automated matches [191610] (1 protein) not a true family |
Protein automated matches [191113] (5 species) not a true protein |
Species Clostridium thermocellum [TaxId:1515] [189176] (7 PDB entries) |
Domain d2ylkd_: 2ylk D: [198767] automated match to d2ylkc_ |
PDB Entry: 2ylk (more details), 2.2 Å
SCOPe Domain Sequences for d2ylkd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ylkd_ b.2.2.0 (D:) automated matches {Clostridium thermocellum [TaxId: 1515]} dvkvqylcentqtsqqeikgkfnivntgnrdyslkdivlryyftkehnsqlqficyytpi gsgnlipsfggsgdehylqlefkdvklpaggqtgeiqfviryadnsfhdqsndysfdpti kafqdygkvtlykngelvwgtppg
Timeline for d2ylkd_: