Lineage for d2ylkd_ (2ylk D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767216Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 2767350Family b.2.2.0: automated matches [191610] (1 protein)
    not a true family
  6. 2767351Protein automated matches [191113] (13 species)
    not a true protein
  7. 2767391Species Clostridium thermocellum [TaxId:1515] [189176] (12 PDB entries)
  8. 2767406Domain d2ylkd_: 2ylk D: [198767]
    Other proteins in same PDB: d2ylka2
    automated match to d2ylkc_

Details for d2ylkd_

PDB Entry: 2ylk (more details), 2.2 Å

PDB Description: Carbohydrate-binding module CBM3b from the cellulosomal cellobiohydrolase 9A from Clostridium thermocellum
PDB Compounds: (D:) Cellulose 1,4-beta-cellobiosidase

SCOPe Domain Sequences for d2ylkd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ylkd_ b.2.2.0 (D:) automated matches {Clostridium thermocellum [TaxId: 1515]}
dvkvqylcentqtsqqeikgkfnivntgnrdyslkdivlryyftkehnsqlqficyytpi
gsgnlipsfggsgdehylqlefkdvklpaggqtgeiqfviryadnsfhdqsndysfdpti
kafqdygkvtlykngelvwgtppg

SCOPe Domain Coordinates for d2ylkd_:

Click to download the PDB-style file with coordinates for d2ylkd_.
(The format of our PDB-style files is described here.)

Timeline for d2ylkd_: