| Class b: All beta proteins [48724] (180 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) ![]() |
| Family b.2.2.0: automated matches [191610] (1 protein) not a true family |
| Protein automated matches [191113] (13 species) not a true protein |
| Species Clostridium thermocellum [TaxId:1515] [189176] (12 PDB entries) |
| Domain d2ylka1: 2ylk A:1-144 [198766] Other proteins in same PDB: d2ylka2 automated match to d2ylkc_ |
PDB Entry: 2ylk (more details), 2.2 Å
SCOPe Domain Sequences for d2ylka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ylka1 b.2.2.0 (A:1-144) automated matches {Clostridium thermocellum [TaxId: 1515]}
dvkvqylcentqtsqqeikgkfnivntgnrdyslkdivlryyftkehnsqlqficyytpi
gsgnlipsfggsgdehylqlefkdvklpaggqtgeiqfviryadnsfhdqsndysfdpti
kafqdygkvtlykngelvwgtppg
Timeline for d2ylka1: