SCOPe 2.08: Domain d2ylka1: 2ylk A:1-144

Lineage for d2ylka1 (2ylk A:1-144)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.0: automated matches [191610] (1 protein)
   not a true family

6. Protein automated matches [191113] (13 species)
   not a true protein

7. Species Clostridium thermocellum [TaxId:1515] [189176] (12 PDB entries)

8. Domain d2ylka1: 2ylk A:1-144 [198766]
   Other proteins in same PDB: d2ylka2
   automated match to d2ylkc_

Details for d2ylka1

PDB Entry: 2ylk, 2.2 Å

PDB Description: Carbohydrate-binding module CBM3b from the cellulosomal cellobiohydrolase 9A from Clostridium thermocellum

PDB Compounds: (A:) Cellulose 1,4-beta-cellobiosidase

SCOPe Domain Sequences for d2ylka1:

Sequence; same for both SEQRES and ATOM records:

>d2ylka1 b.2.2.0 (A:1-144) automated matches {Clostridium thermocellum [TaxId: 1515]}
dvkvqylcentqtsqqeikgkfnivntgnrdyslkdivlryyftkehnsqlqficyytpi
gsgnlipsfggsgdehylqlefkdvklpaggqtgeiqfviryadnsfhdqsndysfdpti
kafqdygkvtlykngelvwgtppg

Timeline for d2ylka1:

• d2ylka1 first appeared in SCOPe 2.03, called d2ylka_
  
• d2ylka1 appears in SCOPe 2.07