Lineage for d2yhfh_ (2yhf H:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234637Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2234638Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2235412Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2235413Protein automated matches [190159] (16 species)
    not a true protein
  7. 2235465Species Human (Homo sapiens) [TaxId:9606] [186882] (78 PDB entries)
  8. 2235575Domain d2yhfh_: 2yhf H: [198762]
    automated match to d2yhfi_

Details for d2yhfh_

PDB Entry: 2yhf (more details), 1.9 Å

PDB Description: 1.9 angstrom crystal structure of clec5a
PDB Compounds: (H:) c-type lectin domain family 5 member a

SCOPe Domain Sequences for d2yhfh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yhfh_ d.169.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mcpkdwefyqarcfflstsesswnesrdfckgkgstlaivntpeklkflqditdaekyfi
gliyhreekrwrwinnsvfngnvtnqnqnfncatigltktfdaascdisyrricekna

SCOPe Domain Coordinates for d2yhfh_:

Click to download the PDB-style file with coordinates for d2yhfh_.
(The format of our PDB-style files is described here.)

Timeline for d2yhfh_: