| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
| Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
| Protein automated matches [190159] (21 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries) |
| Domain d2yhff_: 2yhf F: [198760] automated match to d2yhfi_ |
PDB Entry: 2yhf (more details), 1.9 Å
SCOPe Domain Sequences for d2yhff_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yhff_ d.169.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mcpkdwefyqarcfflstsesswnesrdfckgkgstlaivntpeklkflqditdaekyfi
gliyhreekrwrwinnsvfngnvtnqnqnfncatigltktfdaascdisyrricekna
Timeline for d2yhff_: