Lineage for d1ggil1 (1ggi L:1-107)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7449Species Fab 50.1 (mouse), kappa L chain [48772] (3 PDB entries)
  8. 7456Domain d1ggil1: 1ggi L:1-107 [19876]
    Other proteins in same PDB: d1ggih2, d1ggij2, d1ggil2, d1ggim2

Details for d1ggil1

PDB Entry: 1ggi (more details), 2.8 Å

PDB Description: crystal structure of an hiv-1 neutralizing antibody 50.1 in complex with its v3 loop peptide antigen

SCOP Domain Sequences for d1ggil1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggil1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Fab 50.1 (mouse), kappa L chain}
divltqspgslavslgqratiscrasesvdddgnsflhwyqqkpgqppklliyrssnlis
gipdrfsgsgsrtdftltinpveaddvatyycqqsnedpltfgagtkleik

SCOP Domain Coordinates for d1ggil1:

Click to download the PDB-style file with coordinates for d1ggil1.
(The format of our PDB-style files is described here.)

Timeline for d1ggil1: